DPCstruct | MC19564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 16 aa |
| Standard deviation of domain lengths | 16.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0053 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672JZZ6 | 5-143 | VDCPNQDTAGTSCAISVEKLLERAVQHAELIYRVSEESKLLFDEMLISYGMNLHIPEGTMCAPKTVPVPMSKSEIQQISDKWILHSL… |
| A0A822IDV4 | 10-150 | SSPICTPGSLQCQVLLSDLFDRAIRLSHYIHSLSTEMFEDIDHQYSGGRKLIIKAMNNCHTSTLNTPEDKEQTLQLQHEDLLSLINK… |
| A0A6P8GH09 | 51-245 | None |
| A0A834F881 | 1-182 | None |
| I3MXG6 | 5-154 | None |
| A0A6I9YGV5 | 23-182 | None |
| Q1KZI2 | 1-166 | None |
| A0A061I7I5 | 117-276 | None |
| A0A3Q0CIK9 | 45-187 | None |
| A0A835ZWV5 | 11-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.