DPCstruct | MC19562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15478 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7UKZ7 | 93-233 | LTPMQKSRYMMYEPTSKEILEKQMESLKRVRARKLLAKVDDPAPLLKSLIEHEENSELIGQLKAAEARYRVRNTQLTYDMERSQELQ… |
| A0A822I9I6 | 3-116 | QNRLKEHALKTVSGPKQQVLDPEQERQKKVVGQLKAAEARNRIRLLRIRFQCNRAQEINNLISCQSTARDAIRLEVFLPPRPHAVKS… |
| A0A401SCM4 | 55-161 | None |
| A0A0L8I4G3 | 5-130 | None |
| A0A813VFJ3 | 49-223 | None |
| W5MDE6 | 29-170 | None |
| A0A7N4P9K2 | 97-240 | None |
| A0A1S3LFP1 | 28-175 | None |
| A0A433TY31 | 21-163 | None |
| A0A369SLL8 | 66-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.