DPCstruct | MC1956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 126 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5F1L4 | 2-123 | LRALFVVDSIAVAEPAMAGAVVVCGSHGGVSAARYVLALPARPHAVFFNDAGIGKDQAGIVGLAMLEQVGVIAVAYSHESARIGDAA… |
| A0A7J4ADQ1 | 10-131 | KRLIIVDSLSEVKKAEKGDVIVCGSHGGKSVADYIINNNLFEIGGLIVNDAGIGKNEAGIFALKYLEKYNIPVAAVSHYSAKIGDGE… |
| A0A2E3WDX4 | 103-239 | None |
| A0A0S9QHU7 | 2-130 | None |
| A0A5C8NU38 | 149-270 | None |
| A0A557QKE9 | 5-126 | None |
| A0A8A6S906 | 13-141 | None |
| A0A523WMK4 | 45-173 | None |
| A0A353V086 | 2-123 | None |
| A0A2P4ZWZ8 | 24-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.