DPCstruct | MC19559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.13 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7RQD3 | 11-93 | KTSSLKALLLRAWRERWSDLQWGIHIKTILPRGVSGDVYNLADCILQQALVGPGPNQLVVSYLKHSLSSQLVSYAAVLQRISK |
| A0A822HMY3 | 1-83 | MKLVNLKQAILQAWKERWSDYQWAINMKRFFPKGVTWDILNLAEALLDQAMIGPAPNPLILSYLKYAINSQMVSYSTVLTAIS |
| A0A452UT36 | 1-68 | None |
| S9XHM7 | 17-100 | None |
| A0A1A8BZ27 | 1-84 | None |
| F5H3E6 | 1-83 | None |
| A0A7R9F712 | 12-84 | None |
| A0A3Q2DT36 | 1-71 | None |
| C1C1C7 | 11-98 | None |
| A0A6P6Y6X1 | 21-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.