DPCstruct | MC19557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 87 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0DPX6 | 122-217 | TEDSLRKHPEWHQVELDVHRTLARFPPNISDDRRSTLQCQLTPLIIRVLRTNPRFRYYQGFHDVCLTVLLVCGAETAFEVCRSLAHY… |
| A0A822HFH8 | 1-73 | MDVRRSVKRFPKGMAASERRVLQEQLMDMILCVLRSHPELHYYQGFHDVAVTLLLTVGLRLGTAMLQTLSIHH |
| A0A4Z2HDX7 | 26-108 | None |
| A0A024FZH2 | 56-163 | None |
| A0A444T5C1 | 175-253 | None |
| A0A820N210 | 7-89 | None |
| A0A813WAL8 | 70-162 | None |
| A0A0M3IHW6 | 201-282 | None |
| A0A556UF05 | 65-148 | None |
| D8M5I7 | 56-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.