DPCstruct | MC19556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 105 ± 5 aa |
| Standard deviation of domain lengths | 4.50 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 65.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3C886 | 106-207 | LPRQTCGLFTHTIFYNEYPGGPKELDKSIRGGELFLTVLLNPISIFMTHLSNYGNDRLGLYTFESLVKFVQCWTNLKLQTLPPVQLA… |
| A0A822HDC7 | 1-112 | MVLPRQTCGLFTHTIFYNEYPGGPVELDKIINGGELFLTVLLNPISIFMTHLSNYGNDRLGLYTFKHLVQFLNTWTNLKLQTLPPVQ… |
| A0A6J0WGD3 | 57-158 | None |
| S9WYJ2 | 189-290 | None |
| A0A6V7H8A7 | 273-374 | None |
| A0A0R3QDJ6 | 39-153 | None |
| A0A2K5YYY2 | 59-160 | None |
| H2YCA6 | 390-500 | None |
| H2YCA7 | 1-111 | None |
| A0A0F8AUM6 | 134-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.