DPCstruct | MC19554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 134 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A674HAD3 | 20-146 | AAQPLVDEWLERYRRDREGAFLELLNFTVRSCGCRGVVTPQMFRELQNSEIIRRLTETFQEDSPEYPLSRRSPPWRRFRAGFSELLA… |
| A0A822H931 | 2-130 | QAVVDDWIESYKQDRDIALLDLINFFIQCSGCKGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPHWKKFRSNFCEFIGVL… |
| A0A817NDV1 | 121-248 | None |
| A0A670ZNX8 | 81-220 | None |
| A0A6I9MVJ9 | 103-231 | None |
| A0A453HW34 | 10-143 | None |
| A0A453HVK5 | 9-157 | None |
| A0A0S7JXQ4 | 89-253 | None |
| A0A2G9SCG1 | 153-280 | None |
| A0A3Q3W8Y8 | 55-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.