DPCstruct | MC19551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2SII2 | 5-85 | EEQRYRDRQRQFDEWSRKWVTVTRLKETRLWTDGAIRRWLGEPQQQGKYKVFPVEAVLAAEKLNEFQLWLKPRLEKKRAQH |
| A0A510IEU4 | 23-105 | AMKREQRELERQRQFQQWSQEWITVYRLKKERLWTSGAIKRFLGEPIQQGKYKVFKVEQVRKSERKKAFIQWLAPRLEKKQLD |
| A0A7X5TNR2 | 1-68 | None |
| A0A2P1BPE3 | 5-76 | None |
| A0A2S1PJR4 | 12-103 | None |
| A0A482M1M7 | 12-99 | None |
| A6FFC5 | 14-108 | None |
| Q6TFY8 | 17-99 | None |
| A0A558HFP1 | 12-98 | None |
| A0A447Q8T5 | 8-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.