DPCstruct | MC19550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 115 ± 7 aa |
| Standard deviation of domain lengths | 7.12 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3C299 | 1-109 | MPDGADCDPQYFGFGTQVYYAAAQFQRYRQNPAQFPFHTGITNDIPYSPQASCGSAPVVLANQATAALYNYTPYQPDADLLSGNPGE… |
| A0A7T9MV40 | 195-301 | ACPDGADCDPQYFGFGTQVYYAAAQFQRYRQNPAQFPFHAGITNDIPYSPQASCGSAPVVLANQATAALYNYTPYQPDADLLSGNPG… |
| A0A2I1YBZ7 | 195-315 | None |
| A0A261EZN8 | 269-383 | None |
| A0A258FS34 | 151-270 | None |
| A0A1G9SM59 | 263-373 | None |
| A0A7T0KI13 | 734-844 | None |
| A0A6J7GBF1 | 156-284 | None |
| A0A4Y3UQZ3 | 90-198 | None |
| A0A7T8YNM0 | 96-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.