DPCstruct | MC1955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662KIJ6 | 1-54 | MYDVSTTIQCDRCNYETTRKFERGDYIFKEVGSCPKCKGNLFISSIYREVKEKK |
| A0A7J4ABX5 | 13-70 | LKVKTKTLLECEKCKEKVERDHKEGDYVNKITDEKCPKCSNSMYIKLIYSVQPTVQRS |
| A0A2H1EIM8 | 19-77 | None |
| A0A2R6BVI4 | 37-119 | None |
| A0A842WP34 | 10-77 | None |
| A0A7C4RCF8 | 23-96 | None |
| A0A850LPL5 | 142-210 | None |
| A0A7C5WMY1 | 9-82 | None |
| A0A7C3XRW8 | 8-70 | None |
| A0A432R8L6 | 15-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.