DPCstruct | MC19549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 246 ± 26 aa |
| Standard deviation of domain lengths | 25.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7GLV4 | 1-255 | MRKKKLVALAAAMAADESDDDETEEEIRATIEEVRQELKDKEQKLRKMRDDTLDWLLEAEQQEARANEILDLALQARPKLDVLPAEK… |
| L1L4F5 | 6-211 | AKQSKSADAIEAATAALNEELQQLQHLRDEAAEWLAEMEESDQRARDLRALANMAKTSFPDMAPEQQAAILSMLELKVTVTGPVPDG… |
| A0A1D7YA07 | 184-443 | None |
| A0A7K3ABY9 | 41-282 | None |
| A0A384IRY3 | 391-653 | None |
| A0A3G2JN04 | 62-345 | None |
| A0A542UAQ8 | 1-256 | None |
| A0A4R7H0T0 | 278-532 | None |
| A0A371Q998 | 2-189 | None |
| A0A6G2VEI1 | 390-646 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.