DPCstruct | MC19548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 9.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J7Z2V9 | 2-88 | NKLFMSLREESARKEFLADEAAYCQRFSLSEAQCAAILGRDWQAMLDLGGSIFYIYKLAMMDGLSMQYLGGVFTGMSEAEFKAAMLA |
| A0A1E3ZWI9 | 2-100 | GTTPFDGDQARKGYALNKMCFSFNDEANRKAFVADEEAYMRKYNLNEQQAAAIRAKNVLQLIAAGGNAYYLAKFAGIFQLDMQDIGA… |
| A0A2E2RNK4 | 66-178 | None |
| A0A7X1KMU1 | 4-87 | None |
| A0A521YIN5 | 2-100 | None |
| A0A6M1LET8 | 3-97 | None |
| A0A3D3Q7V8 | 16-126 | None |
| A0A0B2CLC7 | 4-114 | None |
| A0A444GWW0 | 10-113 | None |
| A0A7Y5X3L8 | 13-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.