DPCstruct | MC19547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A486TGD0 | 1-74 | MLFRPVRENDLDDIVRLAARAGVGMTSLPHDVGRLAARIRRSIETFAGELPRSQQGFLFVLEDTALARVVGVSA |
| A0A378EGT0 | 1-75 | MLFRPVRENDLDDIVRLAARAGVGMTSLPHDVGRLAARIRRSIETFAGELPRSQQGFLFVLEDTALARVVGGERH |
| A0A328RBH4 | 5-85 | None |
| A0A3M5DPH1 | 1-86 | None |
| A0A368BYN1 | 3-75 | None |
| A0A5I3FD05 | 1-85 | None |
| A0A2R7RS89 | 1-85 | None |
| A0A455UCN4 | 1-75 | None |
| X1XEU6 | 83-167 | None |
| A0A7G2ITL9 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.