DPCstruct | MC19546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 236 ± 46 aa |
| Standard deviation of domain lengths | 46.22 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF01874- PF03802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8UA58 | 16-283 | QTACLMDVMAPKPGNVARGRDLPGLTYRDLVLSAHAIGPAFRRNARGRPGRLILEAVRTTRRHVATNTNLGIVLLLAPLALAAAATR… |
| A0A378EGA3 | 6-226 | RSLQPTFHALAEQSWRRPADIALRETVGRLGREGEAQMMLATGGVNTHRGAIWALGLLVSAVAMLGGEGQSQAIADAAAALARLPDG… |
| A0A4V1XRB1 | 472-731 | None |
| A0A7C6WHQ4 | 74-327 | None |
| A0A7C4I454 | 2-176 | None |
| A0A7X9P4J9 | 18-340 | None |
| A0A0U3F4M3 | 25-262 | None |
| A0A843LXD0 | 2-167 | None |
| A0A7C5VDX8 | 5-203 | None |
| A0A7X7J9Y5 | 285-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.