DPCstruct | MC19545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A357NHG2 | 61-135 | ARRHPVSLKLGFSAEAFGYAIDLGLPVPGLSMFDREPRIKTECIWAGPFLRSANALVERRGARVRRRAGRGWDLL |
| A0A378EFF4 | 1-77 | MWSGERSPLDRHPRRLQIACRTDSFDYELQIGFPEKLPYPTQFMLDPIVKEENIWLAGYSRRPSSRVLQRKNQAAFL |
| A0A5B7WX31 | 1-81 | None |
| A0A5R4S8B1 | 25-103 | None |
| A0A379AK79 | 31-113 | None |
| A0A4U9HFV9 | 1-87 | None |
| A0A6D0ER37 | 29-100 | None |
| A0A6D0J5T6 | 5-90 | None |
| A0A657AUQ4 | 8-90 | None |
| A0A806QYN8 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.