DPCstruct | MC19543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378EDR6 | 2-82 | VYFLMTSLGELAAFMPVSGSFATYGQNYVEEGFGFALGWNYWYNWAVTIAVDLVASQLVMSYWFPDTPGWIWSALFSASCS |
| A0A3B9Q905 | 24-122 | GPGGALAAYLVIGVMVYFLMTALGSLAAFSPVSGTFAAYGERFVDPGFGYALAVNYVYNWAVTIAVDLVAAQIVISYWFPDIPSWYW… |
| A0A377ZUZ2 | 2-77 | None |
| W7CZG8 | 56-136 | None |
| E2LB21 | 94-180 | None |
| A0A2X3KUG9 | 2-101 | None |
| A0A6S6RY25 | 21-83 | None |
| A0A6D0J585 | 62-142 | None |
| A0A2X2TCP7 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.