DPCstruct | MC19541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.46 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0344- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8PXQ0 | 56-132 | LPMRITDELCDVLQRFHPLWLNIHVNHSNEVSKELETACDKLTRAGIPLGNQSVLLAGVNDNVHIMRQLVQDLVRIR |
| A0A378E939 | 1-76 | MIPARITETLASRFQRSSLQVILVNHVNHANEIDGEFRAAMAMLRQAGVTLLNQSVLLRGVNDNAQTLADLSNALF |
| A0A661LAP0 | 62-142 | None |
| A0A7J4ELH1 | 227-309 | None |
| J6CYG9 | 9-78 | None |
| A0A2E6EMI0 | 195-272 | None |
| A0A1V4FPM9 | 18-81 | None |
| V0B222 | 46-123 | None |
| A0A522BM70 | 261-338 | None |
| A0A6S6RZM2 | 131-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.