DPCstruct | MC1954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Standard deviation of domain lengths | 15.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04019 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2XFU4 | 25-189 | NANFKSLRKKLKKPLGMLIPLEHPYSTDYLKELISFLKPTQIITVGDKITLAAIERGIKPDLAIIDKKAERKDFIFEARKYFKTTIE… |
| A0A7J3SC92 | 8-117 | NIAIVDFHVERRSFQFDPTPYFKNIFKIVNPPGTILASSWLTIQYAISIEESSLILVDGEEDLLALPCILCAPLNSAVFFGIPKRGL… |
| A0A832V0J4 | 6-158 | None |
| A0A7K4A839 | 6-174 | None |
| A0A843D527 | 5-156 | None |
| A0A075FXZ1 | 62-234 | None |
| A0A1F5DE18 | 165-339 | None |
| A0A7M3ZW39 | 3-135 | None |
| A0A1J4TTC7 | 14-187 | None |
| A0A1F6KT82 | 5-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.