DPCstruct | MC19539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831TKX1 | 11-134 | ASLKVSVQHFGRFLSGMVMPNLGAFIAWGLITALFIPTGWIPNEDLSKLVGPMIIYLLPLLIAYTGGNMVYGTRGGVIGVVGTMGVI… |
| A0A378E6P9 | 3-121 | SDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLLPLLIGYTGGKLVGGERGGVVGAITTMGVI… |
| J9LZN6 | 281-410 | None |
| A0A846KGG4 | 2-105 | None |
| A0A516KKC3 | 1-126 | None |
| W7ZLI2 | 2-121 | None |
| A0A1Q2D0J7 | 11-137 | None |
| A0A1X6WKH1 | 2-126 | None |
| A0A6I7FIF5 | 2-117 | None |
| Q98PH0 | 2-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.