DPCstruct | MC19538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2G6E3 | 1-94 | MGCDCCYTNHADADQNLNENLMILLATAGCNYIMGMPLGDDIMLNYQTTAFHDTATVRQLLNLRPSPEFERWLETMGIMANGRLTKR… |
| A0A378DKP5 | 2-120 | VGFIGPEYLYDGKQIIRAGLEDHFCGKLMGLPIGCDVCYTNHAEADQDDMDTLLTLLCAAGLTFLIGVPGADDIMLNYQSTSFHDAL… |
| A0A536SX48 | 119-261 | None |
| A0A150QUW4 | 64-183 | None |
| A0A090N9P7 | 110-241 | None |
| A0A7W1L2I2 | 1-95 | None |
| A0A1V0GXW0 | 186-305 | None |
| A0A6N3R6B3 | 273-402 | None |
| A0A0M4LIZ2 | 213-342 | None |
| A0A6J6I7M4 | 71-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.