DPCstruct | MC19537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 11.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 22.01 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF04381- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2C194 | 14-119 | KEIALSMDELEQQLASLAFTPCSSQDMTKTGWVSPMGDRGEALIHVAGKQVMMCARKEDKILPATVIKQALQDKVEKLEGEQGRKLK… |
| A0A378DKG1 | 3-108 | WFKNLMVYRLSRDIELRAEEMEKQLAELTFTPCGSQDMAKTGWVSPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQ… |
| A0A661LVU0 | 76-195 | None |
| A0A1I1DIK0 | 1-99 | None |
| A0A139DS86 | 23-134 | None |
| A0A2E8RV77 | 16-131 | None |
| A0A077N0W8 | 13-118 | None |
| A0A4Q5XBX8 | 184-298 | None |
| A0A3C1L0L5 | 35-164 | None |
| F4TNA0 | 4-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.