DPCstruct | MC19536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 576 ± 78 aa |
| Standard deviation of domain lengths | 77.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853QVL2 | 23-518 | LDDAGNPLDDAALRRVLTGEDREAWEARNIAARGMGVEPRKQGVWDTIAYGGVNKIVPGETTGGAARANAGSQHRVLHFQNADAHIE… |
| A0A378CP33 | 1-586 | MAQLRGKYHAGINYDFDQAGLVKFIASGSNDREIADAMWRIGRGQKTDGMTPQSVSAAKIIMKWQETARVDENRAGAWIGKMPGYIV… |
| A0A1W9SP22 | 559-1100 | None |
| A0A2N6D7X0 | 533-1237 | None |
| B3PQ24 | 1-460 | None |
| A0A2E0FEA0 | 572-1205 | None |
| A0A6A6K508 | 35-645 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.