DPCstruct | MC19534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4365 |
|---|---|
| Mean domain length (aa) | 200 ± 48 aa |
| Standard deviation of domain lengths | 47.65 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.74 |
| Pfam Score | 37.73 |
| Assigned Pfam label(s) | CL0681- PF16963- CL0020- PF05524- PF06580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3UNY0 | 37-171 | GQKLSDETMAKHPELLSVTLHGNPPGLTETYTMFAGSFPERVGNPDDPDDIDVIKKGITIVDPRWKRVKDNPKKVVILMPMRDAQGE… |
| K2CYQ6 | 6-185 | QQLRLLERITETISYNLDLDEVLMQVVALVSETMKADSCLIYLTQDHHLILKASKIPHPKMINKVALRYGEGITGWVAEHRKIVAVS… |
| A0A7W1E6R8 | 6-189 | None |
| A0A7W1BML3 | 27-194 | None |
| A0A2G4GY88 | 45-234 | None |
| A0A7W0L4N0 | 112-281 | None |
| A0A7W0GAM4 | 122-323 | None |
| U1QXS5 | 111-285 | None |
| A0A2R6KPB8 | 591-811 | None |
| A0A2G6ZGF8 | 258-468 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.