DPCstruct | MC19530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 84 ± 10 aa |
| Standard deviation of domain lengths | 9.85 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T4Z5 | 137-214 | NKRIVITPGEPAGVGPDLVAVLAQQDWPVELVVCADPALLLERARLLKLPLALRDYQPEQPAQPQRAGTLTILPVHIA |
| A0A0B3BR29 | 1-91 | MVKPLIGITMGDAAGVRPEIIMKALSDPQIYKISKPVVIGDAKMLQRAESFLKTGLLIKAIQNVEEAEFKFGVVNCIDLIIRISVNH… |
| A0A7C6WHE5 | 1-79 | None |
| A0A7X8YBP5 | 3-119 | None |
| A0A380VB37 | 1-83 | None |
| A0A225MLI4 | 18-97 | None |
| A0A365CZP3 | 459-536 | None |
| A0A447MXT4 | 1-99 | None |
| A0A644ZRE6 | 9-98 | None |
| A0A2E1VST6 | 176-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.