DPCstruct | MC1953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 6.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370LQD8 | 10-111 | KAWKAKKADVIQFWQNIKPNLPIQMEPVSATHKGTRFRSDGIRITGSPQFINSVLSRIKDIIQLQSGDVRLDVEYREIENKEGDTTP… |
| A0A0F9DC69 | 1-105 | MNKAEMLAHWQSITPDQDIAIEAVAYKHKGSTYDQNGIRLTGSQQFIDSILSRLKELLDYEADDTRLQVVYKQSQDKDTGLPLDSYN… |
| G0LND0 | 16-115 | None |
| A0A0F9HQW8 | 1-115 | None |
| A0A431HHY2 | 24-133 | None |
| A0A2A2F8B5 | 53-154 | None |
| A0A4P5XQS6 | 17-114 | None |
| A0A133VMA6 | 1-114 | None |
| X1A900 | 1-104 | None |
| M0EM51 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.