DPCstruct | MC19526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 17.68 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183KWG3 | 2-69 | LVRLVELGTDPLTLSVAVHDIGEFVRHYPRGKQIIETLGGKQLVMALLQHDDPNVRYNALVSLQKIMV |
| A0A0C9MHV3 | 8-98 | HTSENFWKQNATRLNQDNQQLLRQLTRILSTSTNPTVLAVACHDVGQYVKYNAKDGKRYLQMLGAKQRVMELMTHEDANVRYHALSS… |
| A0A4U0VMB8 | 618-713 | None |
| A0A151GYU4 | 1-92 | None |
| A0A7R8X781 | 347-446 | None |
| A0A7S3GG84 | 590-703 | None |
| A0A7S4QLH4 | 30-129 | None |
| S9V6R7 | 166-287 | None |
| A0A815KBD8 | 370-466 | None |
| A0A2P5WS96 | 290-386 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.