DPCstruct | MC19525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 173 ± 24 aa |
| Standard deviation of domain lengths | 24.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1D1A7 | 298-437 | PPPSAKASAFMKGGDDSDSDGDKKRVVRSHRDKRWDQMQEAVASMKNHIKINDWIAVTEDYDKLNKLLQKAKPIVEREGTPTFYFLA… |
| A0A819F0H2 | 82-242 | NSSSSEENSDDEPQIKIQTTKSFVKSYIINNDDDDDTENVKRIVRSEKDKRYEEIEENIKKIKQVIRIRDIKQVYECFENLIKVYDK… |
| A0A4W5N9A4 | 1-197 | None |
| A0A4D9DLL4 | 120-266 | None |
| A0A6A4ZZV9 | 2-198 | None |
| A0A820E1C5 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.