DPCstruct | MC19524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367J4Y6 | 1-80 | MKFSTVALLLAAVAGIQAAAITNPECKALGDKCIHKACGTKSGTGYKGYCCLTDDDCIRSCVNNQCTGIKNPKFSNPIPD |
| A0A1X0QPT0 | 1-78 | MKLSLSIFLLAAAALQVQAAANPVHAAAAKCISGSAGKGNGDGYKGYCCKNSDDCFESCVSGVCNGPTKPTKTTTSSA |
| A0A367K7L7 | 42-129 | None |
| A0A367IYN9 | 1-71 | None |
| A0A162T627 | 7-82 | None |
| A0A1C7N3T7 | 66-129 | None |
| A0A0C9M8W5 | 142-220 | None |
| I1CP36 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.