DPCstruct | MC19523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0367 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9LWV4 | 1-78 | MEESNNNVAEWEEKLVGKILLEDDAEHTLKDDEVVRIKDLPSYHRVLPPGAIMTRDYRVDRLNVFIDDNRKVERVYYA |
| A0A6A6WJJ9 | 1-69 | MADRAEEWKTKLIGKKLGDNHDDSTFSKTDLPEGHRVLEENEPTTKEFFVDRLNVVKDKEGVVSRSPTS |
| A0A2G5B4T7 | 32-103 | None |
| A0A3M7M379 | 409-486 | None |
| A0A1L9VHQ0 | 1-78 | None |
| A0A2P6NI21 | 270-357 | None |
| A0A6A5YP99 | 345-409 | None |
| A0A063BS23 | 95-175 | None |
| A0A167ANA4 | 78-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.