DPCstruct | MC19522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 136 ± 25 aa |
| Standard deviation of domain lengths | 24.69 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 96.01 |
| Assigned Pfam label(s) | PF02770- CL0544 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HTY3 | 3-138 | WQTHTVFNQPTPLNNSNLFLSDTALREAVVREGAGWDGDLLASIGQQLGTAESLELGRLANSNPPELLRYDATGARLDDVRFHPAWH… |
| M3B6E9 | 70-201 | SGTAAESFKLRLQPLKNPYTSDLAYQRVLSWYLPPHILEELNPKLIKYGNEAISDQINDWISDAERNPPYLKKRDVWTNEFPHDKLI… |
| A0A4V2S6E4 | 18-129 | None |
| A0A1B8EJ36 | 1-150 | None |
| A0A842Z4W8 | 1-101 | None |
| A0A1X7UCA5 | 259-402 | None |
| A0A4Y2ARP2 | 62-198 | None |
| A0A7I8DC63 | 11-140 | None |
| A0A0P7GKU7 | 1-157 | None |
| A0A1Q5T819 | 8-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.