DPCstruct | MC1952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 139 ± 15 aa |
| Standard deviation of domain lengths | 15.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 36.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0S5W2 | 1-104 | MWTGYEEALVRYGLDMCDVWVAAGRADTTAATMRADVAAARALTVIRTQPELAAAGELPPWLGDDALHLSHRSALVRKDPDFYRPLF… |
| A0A370LQ02 | 2-113 | GKQRLETLHILKVITGKSDAWGKHPIIAMWQGHARALSEYGIAICNEWISRGYKDSRLPIIKTFRKGKLVYPSWIGNEDFHAAHRAA… |
| A0A133ULM1 | 3-130 | None |
| A0A7C5X945 | 1-140 | None |
| A0A0Q0WM28 | 13-153 | None |
| A0A0G0A1G8 | 2-143 | None |
| A0A5C7Q5K9 | 5-149 | None |
| K0SAJ3 | 6-148 | None |
| A0A3M1UDL5 | 1-150 | None |
| A0A075URG4 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.