DPCstruct | MC19519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 135 ± 24 aa |
| Standard deviation of domain lengths | 24.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9G6S6 | 4-118 | ESHPAVGNHVINQLAFSRLSSTPLSTIMAHLPSEEKRDISKDDLRDVIESTPCIGIIKRQGKDAAGKPLESEYYYVPEEDDDQQRRA… |
| M2Z9K5 | 16-142 | SPVKNHVINQLAFSRIHSLPLSTIHSNLPAELRGAMVKPSDNENQKVLTTGELKTLLDDIPCVGEIRREGKDAAGKLLESEFYYVPE… |
| A0A197JTE3 | 475-638 | None |
| A0A1V8UWY9 | 210-348 | None |
| A0A1B7TCD4 | 176-331 | None |
| A0A395J2C3 | 265-381 | None |
| A0A168I1E3 | 13-129 | None |
| H0ELR6 | 1-206 | None |
| A0A4Q2D192 | 493-627 | None |
| B8P1U8 | 118-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.