DPCstruct | MC19518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 25.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF11807- PF20481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484FMK1 | 6-130 | TAEARANGCKYDILLNHWVPAACFDRNSVEEYREDESWGAYADINMTQRLTVDEMSERDFYWTSIRDHVNHCAIMWRRQFYALYDER… |
| M2YYH5 | 19-205 | LFELTKAAIQHFKAGPPANAGKDYGDLSWYCRRDCGKSWEEAEPKGCVFDELEFRFTHPECINDDAQKDFAESGPGPDGKWLYAIDV… |
| A0A2V1DLT7 | 11-161 | None |
| A0A142I734 | 145-332 | None |
| N4VFF2 | 3-148 | None |
| A0A1Z5TEC0 | 36-204 | None |
| A0A146FFB1 | 20-159 | None |
| W6XJE0 | 21-181 | None |
| A0A1M3T4M7 | 9-172 | None |
| A0A2V5IE20 | 61-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.