DPCstruct | MC19513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 14.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6U1Z4 | 82-188 | RQSLKLLGELLLDRHNYTIMTKYISRPENLKIMMNNLRDQSRNIQFEAFHVFKVFVANPNKTKPILDILLKNQQKLVDFLTNFHNDR… |
| A0A453B6Z2 | 5-99 | MLLDRSNSAVMMRYVSSKDNLMILMNLLRDSSKNIQIESFHVFKLFAANKNKPAEVVNILVTNRSKLLRFFAGFKTDKEDEQFEADK… |
| D8LIL1 | 15-97 | None |
| B7FR08 | 1-78 | None |
| G4URQ4 | 33-150 | None |
| A0A6P3Z690 | 77-158 | None |
| A0A183WZW4 | 2-113 | None |
| A0A4S4DSH8 | 280-386 | None |
| A0A164ZVL0 | 229-341 | None |
| A0A0A9EJF5 | 3-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.