DPCstruct | MC19511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 208 ± 39 aa |
| Standard deviation of domain lengths | 39.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8A7S5 | 33-231 | TSRVSSYQHTSVTLEFFETVVRYEKFFTVEPQHIPCVLMAFLSHRGLRHSSAKVRRTAYLFSRFVKSLNKQMNPFIEDILNRIQDLL… |
| A0A453B3W4 | 1-188 | VALVYLETVTRYIKFMQENVQYVPHLLAAFLDERGIHHQNSHVSRRAGYLFMKAVKLLKAKLVPYLDTILQSLEDVLGQFTSMDWAN… |
| A0A287HKP4 | 7-197 | None |
| A0A061S0Z3 | 318-637 | None |
| A0A261XSV9 | 332-519 | None |
| A0A0B2V388 | 75-315 | None |
| A0A0L0T804 | 54-292 | None |
| D3ZZ62 | 488-666 | None |
| A0A433PQD3 | 9-220 | None |
| A0A132AIT3 | 139-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.