DPCstruct | MC19508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 57.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6HIL5 | 80-170 | VKSTILHFQLRNLVWATSKHDIYLVSHYSIRHWSALSGVDTELINVQGHVAPREKHAGSLLEGFYQTQVSTLTVKDNLLVAGGFQGE… |
| A0A453B1H9 | 1-85 | DHSYSWYLQLRNLVWATSKHDVYMAQNNSVMHWSSLLQRGTEVLHVAGQVVPKQKTHGARTLSRVQISTMALKDNLMVAGGFRGE |
| A0A287HJ59 | 28-116 | None |
| A0A453RI60 | 1-109 | None |
| A0A453RWE2 | 120-225 | None |
| A0A287WBA2 | 16-126 | None |
| A0A804LL55 | 127-216 | None |
| A0A453B1N0 | 158-258 | None |
| A0A2V0P2Q6 | 309-388 | None |
| A0A5P1FTR0 | 161-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.