DPCstruct | MC19507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05460 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9GM69 | 1-88 | MIPELAKRLGVTSDKAIRKAQEYERLLRLKTAASGFHIQGTTKMVVCLDLAASAENQTVDKDLSLKLSGLKNSAYRATKQTIKQVLGL |
| A0A2K5YUK9 | 6-92 | IGRLARRLGLAEPDMLRKAEEYLRLSRLKCVGLSARTTETSRAVMCLDLAASWMKCPLDRAYLIKLSGLNKKTYQSCLKSFECLLGL |
| A0A7J7MYU9 | 1-90 | None |
| A0A653BPL2 | 646-731 | None |
| A0A388LE96 | 1-100 | None |
| A0A6P4Z5C3 | 6-94 | None |
| A0A1Y1HU87 | 1-91 | None |
| A0A2Y9KZ79 | 6-93 | None |
| A0A6U8HBD9 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.