DPCstruct | MC19505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 281 ± 65 aa |
| Standard deviation of domain lengths | 65.42 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.46 |
| Pfam Score | 93.25 |
| Assigned Pfam label(s) | CL0020- PF20175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3IP28 | 325-568 | TIVNKSMELAMTAKEPYNYFLLLRALFRSIGGGSHDLLYQEFLPLLPNLLQGLNSLQSGLHKQHMKDLFVELCLTVPVRLSSLLPYL… |
| A0A453AWZ3 | 1-278 | VPVIMEVCMKSATEVEKPLGYMHLLRSMFRALNSAKFDSLMRDLIPSLQPCLNLLLSMLDGPTTADMRDLILELCLILPARLSSLLP… |
| A0A6P8H9X7 | 782-1035 | None |
| A0A4U8UST7 | 170-553 | None |
| A0A183WD66 | 98-431 | None |
| A0A5B0NX64 | 4-189 | None |
| A0A821C509 | 1-354 | None |
| A0A4Z2G6M3 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.