DPCstruct | MC19504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 2.91 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8ZFS2 | 51-102 | AEEECCRWLKEVDTKCVCDLLVYLPTFLAKPRHNYTVTVAQDCTVTYECPSR |
| A0A453AVF2 | 1-52 | RAYRDCCRWLKEVEPGCVCESLLHLPMFLVKPQHKYTLRVGKTCEVTYRCGG |
| A0A445CKR2 | 215-266 | None |
| A0A0P0X9X1 | 103-154 | None |
| A0A6N2MD81 | 82-131 | None |
| A0A830CNQ8 | 59-107 | None |
| A0A6P4AZX7 | 89-144 | None |
| A0A7J8URE5 | 183-232 | None |
| A0A804KR70 | 65-118 | None |
| A0A328DQK6 | 91-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.