DPCstruct | MC19502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 448 ± 85 aa |
| Standard deviation of domain lengths | 85.03 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3X3T8 | 5-451 | QPPRGFGDNPVAIYHDPDLPPSHHYLAAYRWLETGFGAHAVVHLGKHGNLEWLPGKTLGMSAACGSDAALGNLPLIYPFLVNDPGEG… |
| A0A453AUX3 | 556-1080 | MNVREYQALTPYANMLEENWGKPPGHLNSDGENLLVYGKQYGNIFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTFVEKIFKAD… |
| A0A7V0JTZ9 | 291-705 | None |
| A0A1U7PZB8 | 129-581 | None |
| A0A059WXY4 | 2-390 | None |
| A0A7S1TGH0 | 54-617 | None |
| A0A7G9ZA00 | 1-513 | None |
| A0A0Q3NW02 | 349-873 | None |
| A0A0B8PBR4 | 1-338 | None |
| A0A1V1P9F8 | 93-602 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.