DPCstruct | MC19501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 124 ± 21 aa |
| Standard deviation of domain lengths | 21.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848VFG9 | 360-460 | DVVATLQAAVRSGDYNRYRDYAELVDERPVATLRDLLEPQAIGPPVAIDDVEPAENILRRFDSAGMSLGALSPEAHEALAIAMNRLG… |
| A0A453AU24 | 285-397 | GFIQSRPGGEFHANNPEMSKLLHKAIREKSDNAYTIYQQHLASRPVNVLRDLVELKSERTPIPIGKVEPATSIVERFCTGGMSLGAI… |
| A0A7J6Q1R0 | 637-801 | None |
| A0A438DKJ8 | 144-271 | None |
| A0A376FFX0 | 120-228 | None |
| A0A809WN68 | 150-282 | None |
| A0A0Q9XCL6 | 875-993 | None |
| A0A453FCX1 | 153-321 | None |
| A0A5K4EM75 | 600-725 | None |
| A0A847JY43 | 512-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.