DPCstruct | MC19500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 522 ± 33 aa |
| Standard deviation of domain lengths | 32.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.02 |
| Pfam Score | 90.30 |
| Assigned Pfam label(s) | CL0063- CL0123- CL0196- CL0487- PF18441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453AQP6 | 115-625 | NFPTSYHPLVGHLSVTLRRTGDLLGKLPISAIVACDVKVHILCKIIDPKAEFDPLLVLSMIYNAAKQSLGVSVSSRNLWIQSQRPYS… |
| A0A7C9CGR4 | 2-512 | LIAVSEEELWIRRREPYPCDLMESLIHQQSPMTSEACIEAVCIPFSLDKDVTSMSLNLGSKGYYLDIIAQDLGVVDASKVLISRVIG… |
| A0A811NRH3 | 42-479 | None |
| A0A6J0ME23 | 106-646 | None |
| A0A7J7LA33 | 3-545 | None |
| A0A453BLF7 | 1-543 | None |
| A0A834ZNA1 | 298-837 | None |
| A0A6P4Q590 | 2-487 | None |
| A0A6A3D1T8 | 130-635 | None |
| A0A6J0PSE0 | 119-691 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.