DPCstruct | MC1950
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 27.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9UE02 | 222-352 | NQFFDIWTKYSESAVRRTDALDKLHRDYDYFDKNAKVFIRDLKLFGSKPDSRTRLLGTRHRYFLGEPYFSSALVGLILVLPLQTTTV… |
| C6HQP8 | 23-182 | FHISDLKSDKFPALWYRIHVLVYDLRNFATDPTARERLESVVDVTYLGQPYFNAEEVAALTRTAVGHDGETLKERIQHTLEERLNRR… |
| A0A060SND8 | 3-147 | None |
| A0A6A5XVW4 | 11-166 | None |
| L2FEC1 | 455-604 | None |
| A0A1G4B2H5 | 11-174 | None |
| A0A093YEN6 | 13-208 | None |
| A0A094J2L6 | 1-208 | None |
| A0A1L9WUU0 | 3-181 | None |
| A0A4P9WH81 | 166-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.