DPCstruct | MC195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345VJG8 | 1-79 | MAITDKDFNEISNRVYNVDRKKQGVLHIRAGQEIMEGKYKVLKVEDNPDNGMQAMAVVPVDKNGKADYSEVVIAYAGTN |
| A0A165CWV6 | 28-102 | MVHTDQDFRNLSEESYENYEIGDTVKHDGKTFEIMEKRDDTQNGLRSYAFAPVVNGKPDTNNIVMGYAGTGPLSM |
| A0A139NTL0 | 1-100 | None |
| A0A2C6U8G0 | 7-92 | None |
| A0A2C6VGA4 | 1-81 | None |
| A0A081R5R6 | 3-108 | None |
| A0A6D2LCP6 | 1-63 | None |
| A0A3M2HTS3 | 1-101 | None |
| A0A1X3DCH2 | 1-93 | None |
| A0A1E5KUI5 | 133-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.