DPCstruct | MC19498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 10.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022PN09 | 70-132 | SGQICQICGDEVEFTVDGEPFVACNECAFPVCRSCYEYDRREGNQSCPQCKTRFKRIKGSPRV |
| A0A453ANF7 | 3-73 | GDADALKSGRHGAGDVCQICADGLGTTVDGEVFTACDVCRFPVCRPCYEHERKEGTQACLQCKTKYKRHRG |
| A0A392RLS5 | 1-63 | None |
| A0A482VVB1 | 515-567 | None |
| A0A0M3IIA6 | 22-86 | None |
| A0A444X3Y6 | 5-75 | None |
| A0A444X3E0 | 12-99 | None |
| A0A6D2I2P7 | 15-107 | None |
| A0A6P5GR15 | 106-175 | None |
| A0A6D2JNU6 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.