DPCstruct | MC19495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 263 ± 20 aa |
| Standard deviation of domain lengths | 20.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453AFH9 | 1-242 | MLASNQMSPQTLFYVWNHWKLIIIKVLSHLRHTDGPELNDYAVMYEDLCAKYFGLRKDGEVDRYVVLNINASWLSIAGRNSLQQDGN… |
| A0A287J7Z9 | 281-514 | MVARNQISPQTLAYAWNHWKSIIIEVLSHLHHTDGPELNDYEVMYEDFCSKYFGLRKDGEDDRYVVLNMNSSWLSNAGRNSLQQDGN… |
| A0A0P0WE98 | 1797-2062 | None |
| A0A7J6W032 | 459-701 | None |
| A0A438JRV3 | 117-396 | None |
| A0A1U8MZ82 | 2-254 | None |
| A0A1D6E0S0 | 172-432 | None |
| A0A7J6GAP0 | 110-392 | None |
| A0A5C7HIN8 | 12-315 | None |
| A0A2U1LB10 | 908-1166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.