DPCstruct | MC19493
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 491 ± 59 aa |
| Standard deviation of domain lengths | 59.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287F5E0 | 2-431 | MCSKAEIELYLSSLGSKRITRINRNCNPISWASGCQSGWACSTPDPNSFANNSFENPVPSRAENCRPCCPGFFCPRELTCMMPCPLG… |
| A0A453ADK8 | 1-490 | MPQRLCTPAEAKFYFTSLYNPKGEKNLFLETNINCGISAWSPGCEPGWACSVGPIPAANDNETIPLRATNCQACCEGFFCPRGLTCM… |
| A0A7J7H4I8 | 35-598 | None |
| A0A6V7PJ11 | 20-521 | None |
| A0A4Y7KXQ7 | 12-516 | None |
| A0A061ET91 | 44-595 | None |
| A0A7J7FSB2 | 1-597 | None |
| A0A287V6I8 | 1-382 | None |
| A0A453ADE6 | 72-571 | None |
| A0A1D6HPS3 | 1-457 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.