DPCstruct | MC19492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 95 ± 3 aa |
| Standard deviation of domain lengths | 3.04 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 87.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 71.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0108- PF03999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453ABD8 | 1-88 | MQKVIGEGVEAYDKLQNDLVTAKERLTNILQSKDRKKTLLDMVERNELNMSILTLLDENIASAKTSNQEEAVAFMEDVRSSMLKYITV |
| A0A287GYT0 | 70-166 | EDRLIELEAMQKVIGEGVEAYDKLQNDLVTAKERLTNILQSKDRKKTLLDMVERNELNMSILTLLDENIGSAKASNQEEAVAFMEDV… |
| A0A6A6LEV4 | 93-190 | None |
| A0A0A9GJD3 | 1-98 | None |
| A0A3L6PBR7 | 151-245 | None |
| A0A1Y1HKP8 | 161-257 | None |
| A0A835IG30 | 50-144 | None |
| A0A835IBI0 | 37-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.