DPCstruct | MC19491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 311 ± 53 aa |
| Standard deviation of domain lengths | 52.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07782 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7G1R4 | 14-213 | VMIYTIFRDSVKMINNYLNDIDFDNVYLTSYFWHIDRKRKNEAKIFLHPLSKAEMRANNLMTPISPPTKAEIRASWLPLAKFTFLFI… |
| A0A158PCW6 | 14-324 | NVLRILQRLINAKSFILFVYCIDGKLKASAPTALFTYNFNYREEFENNFLTDEFDKIDLDMALRGQTKVLPLNKNEKLQYIRRASWK… |
| A0A1S3IFN8 | 540-860 | None |
| T1FB36 | 151-548 | None |
| T1F962 | 289-657 | None |
| T1KVI9 | 350-713 | None |
| A0A7M7LSQ9 | 868-1225 | None |
| A0A7M3RGL2 | 740-1108 | None |
| A0A2I4CVA2 | 287-546 | None |
| A0A0V0YBR8 | 513-861 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.