DPCstruct | MC19490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4TT99 | 23-119 | CIDKFCPPGTFCDERPGPCVKPPCRTILACLPVEANGCARMECSAPKVCVERVRPCIGRSCKEIATCETPNTCAAVVCPPSQKCELE… |
| A0A158PAN5 | 4-97 | GTFCDQRFGPCKRPPCRPILLCVPDKFNGCAGISCPTGQICIARSRPCIGRSCKKYPSCVKPGTCDALVCLPSQKCVADPTPKCITD… |
| A0A0N5CSV3 | 32-114 | None |
| F1LE03 | 167-251 | None |
| A0A1B6H395 | 148-255 | None |
| A0A4X3P7N7 | 12-130 | None |
| A0A0R3RI55 | 2-97 | None |
| A0A7E4WBD3 | 32-129 | None |
| A0A2G9UXB2 | 102-200 | None |
| A0A3P7MIZ7 | 15-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.